Step 1. View Your Annotated Targets.

Retrieve your CSGID target info using GI codes:

Enter your proteins GI codes here (maximum 20 proteins at a time please): 206583858 240248243 52208929 OR: Enter the proteins GIs from a file (maximum 20 proteins at a time please): Options: include other information (saved from Excel): protein sequences DNA sequences subtargets justification codes protocol codes [Get help on the required file format] OR: Sequences provided with GIs in FASTA format: [Get help on the required file format] Percentage sequence identity cutoff for PDB alignments: 100 95 90 80 70 60 50 Percentage sequence identity cutoff for TargetDB alignments: 100 95 90 80 70 60 50

OR

If you do not have a GI code for each target, try aligning your sequence/s against our pre-annotated genomes:

Paste your sequence: LKSTTAHNLKKDVLTITAPNEFARDWLESHYSELISETLYDL Filename: Genome to search: test Bacillus anthracis str. Ames Bacillus anthracis str. Sterne Bacillus cereus ATCC 10987 Bacillus cereus ATCC 14579 Borrelia burgdorferi B31 Burkholderia mallei ATCC 23344 Campylobacter jejuni subsp. jejuni NCTC 11168 Clostridium difficile 630 Coxiella burnetii RSA 493 Escherichia coli CFT073 Escherichia coli K12 substr. MG1655 Escherichia coli O157:H7 EDL933 Escherichia coli O157:H7 str. Sakai Francisella tularensis subsp. tularensis SCHU S4 Helicobacter pylori 26695 Helicobacter pylori J99 Listeria monocytogenes 1/2a F6854 Listeria monocytogenes EGD-e Listeria monocytogenes str. 4b F2365 Listeria monocytogenes str. 4b H7858 Mycobacterium tuberculosis CDC1551 Mycobacterium tuberculosis H37Rv Neisseria gonorrhoeae FA 1090 Neisseria meningitidis MC58 Pseudomonas aeruginosa PAO1 Rickettsia prowazekii str. Madrid E Salmonella enterica subsp. enterica serovar Typhi str. CT18 Salmonella enterica subsp. enterica serovar Typhi Ty2 Shigella flexneri 2a str. 2457T Staphylococcus aureus subsp. aureus COL Staphylococcus aureus subsp. aureus MRSA252 Staphylococcus aureus subsp. aureus Mu50 Staphylococcus aureus subsp. aureus MW2 Streptococcus agalactiae 2603V/R Streptococcus pneumoniae R6 Streptococcus pneumoniae TIGR4 Vibrio cholerae O1 biovar El Tor str. N16961 Yersinia pestis CO92 Yersinia pestis KIM Yersinia pseudotuberculosis IP 32953 Matrix: PAM 70 BLOSUM62 BLOSUM80 Number of iterations: E-value: 0.00001 0.0001 0.001 0.01 1 10 100 Low complexity filter: Number of alignments: 0 10 50 100 250 500 1000

OR

Try finding the GI code at the NCBI main site or the NCBI BLAST site.

Please report any problems on this web page to phil@biochem.ucl.ac.uk

CSGID